Lineage for d1nr0a1 (1nr0 A:2-312)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 807549Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 807635Superfamily b.69.4: WD40 repeat-like [50978] (2 families) (S)
    also contains 8-bladed propellers
  5. 807636Family b.69.4.1: WD40-repeat [50979] (10 proteins)
    this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain
  6. 807637Protein Actin interacting protein 1 [89378] (2 species)
    14 repeats are arranged into two seven-bladed beta-propeller domains swapped with the N-terminal strands
  7. 807645Species Nematode (Caenorhabditis elegans) [TaxId:6239] [89379] (2 PDB entries)
  8. 807646Domain d1nr0a1: 1nr0 A:2-312 [86078]

Details for d1nr0a1

PDB Entry: 1nr0 (more details), 1.7 Å

PDB Description: two seven-bladed beta-propeller domains revealed by the structure of a c. elegans homologue of yeast actin interacting protein 1 (aip1).
PDB Compounds: (A:) Actin interacting protein 1

SCOP Domain Sequences for d1nr0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
sefsqtalfpslprtargtavvlgntpagdkiqycngtsvytvpvgsltdteiytehshq
ttvaktspsgyycasgdvhgnvriwdttqtthilkttipvfsgpvkdiswdseskriaav
gegrerfghvflfdtgtsngnltgqaramnsvdfkpsrpfriisgsddntvaifegppfk
fkstfgehtkfvhsvrynpdgslfastggdgtivlyngvdgtktgvfeddslknvahsgs
vfgltwspdgtkiasasadktikiwnvatlkvektipvgtriedqqlgiiwtkqalvsis
angfinfvnpe

SCOP Domain Coordinates for d1nr0a1:

Click to download the PDB-style file with coordinates for d1nr0a1.
(The format of our PDB-style files is described here.)

Timeline for d1nr0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nr0a2