SCOP 1.65: Domain d1nr0a1: 1nr0 A:2-312

Lineage for d1nr0a1 (1nr0 A:2-312)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (10 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.4: WD40-repeat [50978] (1 family)
   also contains 8-bladed propellers

5. Family b.69.4.1: WD40-repeat [50979] (7 proteins)
   this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain

6. Protein Actin interacting protein 1 [89378] (2 species)
   14 repeats are arranged into two seven-bladed beta-propeller domains swapped with the N-terminal strands

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [89379] (2 PDB entries)

8. Domain d1nr0a1: 1nr0 A:2-312 [86078]

Details for d1nr0a1

PDB Entry: 1nr0, 1.7 Å

PDB Description: two seven-bladed beta-propeller domains revealed by the structure of a c. elegans homologue of yeast actin interacting protein 1 (aip1).

SCOP Domain Sequences for d1nr0a1:

Sequence; same for both SEQRES and ATOM records:

>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans)}
sefsqtalfpslprtargtavvlgntpagdkiqycngtsvytvpvgsltdteiytehshq
ttvaktspsgyycasgdvhgnvriwdttqtthilkttipvfsgpvkdiswdseskriaav
gegrerfghvflfdtgtsngnltgqaramnsvdfkpsrpfriisgsddntvaifegppfk
fkstfgehtkfvhsvrynpdgslfastggdgtivlyngvdgtktgvfeddslknvahsgs
vfgltwspdgtkiasasadktikiwnvatlkvektipvgtriedqqlgiiwtkqalvsis
angfinfvnpe

Timeline for d1nr0a1:

• d1nr0a1 is new in SCOP 1.65
  
• d1nr0a1 appears in SCOP 1.67
  
• d1nr0a1 appears in the current release, SCOPe 2.08