Class b: All beta proteins [48724] (174 folds) |
Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) |
Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins) |
Protein Streptavidin [50878] (1 species) |
Species Streptomyces avidinii [TaxId:1895] [50879] (118 PDB entries) |
Domain d1nqmb_: 1nqm B: [86039] complexed with btn; mutant |
PDB Entry: 1nqm (more details), 1.7 Å
SCOPe Domain Sequences for d1nqmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nqmb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]} gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanakkstlvghdtftkvk
Timeline for d1nqmb_: