SCOPe 2.05: Domain d1nqla4: 1nql A:481-614

Lineage for d1nqla4 (1nql A:481-614)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.9: Growth factor receptor domain [57184] (2 families)

5. Family g.3.9.1: Growth factor receptor domain [57185] (9 proteins)

6. Protein EGF receptor Cys-rich domains [82887] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82888] (6 PDB entries)

8. Domain d1nqla4: 1nql A:481-614 [86036]
   Other proteins in same PDB: d1nqla1, d1nqla2, d1nqlb_
   complexed with EGF
   complexed with nag

Details for d1nqla4

PDB Entry: 1nql, 2.8 Å

PDB Description: structure of the extracellular domain of human epidermal growth factor (egf) receptor in an inactive (low ph) complex with egf.

PDB Compounds: (A:) Epidermal growth factor receptor

SCOPe Domain Sequences for d1nqla4:

Sequence; same for both SEQRES and ATOM records:

>d1nqla4 g.3.9.1 (A:481-614) EGF receptor Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]}
vchalcspegcwgpeprdcvscrnvsrgrecvdkckllegeprefvenseciqchpeclp
qamnitctgrgpdnciqcahyidgphcvktcpagvmgenntlvwkyadaghvchlchpnc
tygctgpglegcpt

Timeline for d1nqla4:

• d1nqla4 first appeared in SCOP 1.65
  
• d1nqla4 appears in SCOPe 2.04
  
• d1nqla4 appears in SCOPe 2.06
  
• d1nqla4 appears in the current release, SCOPe 2.08