Lineage for d1nqla2 (1nql A:312-480)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 310356Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N
  4. 310397Superfamily c.10.2: L domain-like [52058] (8 families) (S)
    less regular structure consisting of variable repeats
  5. 310441Family c.10.2.5: L domain [52071] (4 proteins)
  6. 310442Protein EGF receptor extracellular domain [82326] (1 species)
  7. 310443Species Human (Homo sapiens) [TaxId:9606] [82327] (2 PDB entries)
  8. 310445Domain d1nqla2: 1nql A:312-480 [86034]
    Other proteins in same PDB: d1nqla3, d1nqla4, d1nqlb_
    complexed with aso, nag

Details for d1nqla2

PDB Entry: 1nql (more details), 2.8 Å

PDB Description: Structure of the extracellular domain of human epidermal growth factor (EGF) receptor in an inactive (low pH) complex with EGF.
PDB Compounds: (A:)

SCOP Domain Sequences for d1nqla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nqla2 c.10.2.5 (A:312-480) EGF receptor extracellular domain {Human (Homo sapiens)}
vcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqeldil
ktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslglrslke
isdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgq

SCOP Domain Coordinates for d1nqla2:

Click to download the PDB-style file with coordinates for d1nqla2.
(The format of our PDB-style files is described here.)

Timeline for d1nqla2: