SCOPe 2.04: Domain d1nqla1: 1nql A:3-162

Lineage for d1nqla1 (1nql A:3-162)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.5: L domain [52071] (6 proteins)
   this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain

6. Protein EGF receptor extracellular domain [82326] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82327] (7 PDB entries)

8. Domain d1nqla1: 1nql A:3-162 [86033]
   Other proteins in same PDB: d1nqla3, d1nqla4, d1nqlb_
   complexed with EGF
   complexed with nag

Details for d1nqla1

PDB Entry: 1nql, 2.8 Å

PDB Description: structure of the extracellular domain of human epidermal growth factor (egf) receptor in an inactive (low ph) complex with egf.

PDB Compounds: (A:) Epidermal growth factor receptor

SCOPe Domain Sequences for d1nqla1:

Sequence; same for both SEQRES and ATOM records:

>d1nqla1 c.10.2.5 (A:3-162) EGF receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
ekkvcqgtsnkltqlgtfedhflslqrmfnncevvlgnleityvqrnydlsflktiqeva
gyvlialntveriplenlqiirgnmyyensyalavlsnydanktglkelpmrnlqeilhg
avrfsnnpalcnvesiqwrdivssdflsnmsmdfqnhlgs

Timeline for d1nqla1:

• d1nqla1 first appeared in SCOP 1.65
  
• d1nqla1 appears in SCOPe 2.03
  
• d1nqla1 appears in SCOPe 2.05
  
• d1nqla1 appears in the current release, SCOPe 2.08