SCOPe 2.06: Domain d1nqaq2: 1nqa Q:149-312

Lineage for d1nqaq2 (1nqa Q:149-312)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (6 proteins)
   has many additional secondary structures

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (20 species)

7. Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [55351] (11 PDB entries)

8. Domain d1nqaq2: 1nqa Q:149-312 [86021]
   Other proteins in same PDB: d1nqao1, d1nqap1, d1nqaq1, d1nqar1
   complexed with g3h, nad; mutant

Details for d1nqaq2

PDB Entry: 1nqa, 2.2 Å

PDB Description: glyceraldehyde-3-phosphate dehydrogenase mutant with cys 149 replaced by ala complexed with nad+ and d-glyceraldehyde-3-phosphate

PDB Compounds: (Q:) glyceraldehyde 3-phosphate dehydrogenase

SCOPe Domain Sequences for d1nqaq2:

Sequence; same for both SEQRES and ATOM records:

>d1nqaq2 d.81.1.1 (Q:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]}
attnclapfakvlheqfgivrgmmttvhsytndqrildlphkdlrraraaaesiiptttg
aakavalvlpelkgklngmamrvptpnvsvvdlvaelekevtveevnaalkaaaegelkg
ilayseeplvsrdyngstvsstidalstmvidgkmvkvvswyd

Timeline for d1nqaq2:

• d1nqaq2 first appeared in SCOP 1.65
  
• d1nqaq2 appears in SCOPe 2.05
  
• d1nqaq2 appears in SCOPe 2.07
  
• d1nqaq2 appears in the current release, SCOPe 2.08