Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (3 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species) |
Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [55351] (10 PDB entries) |
Domain d1nqaq2: 1nqa Q:149-312 [86021] Other proteins in same PDB: d1nqao1, d1nqap1, d1nqaq1, d1nqar1 |
PDB Entry: 1nqa (more details), 2.2 Å
SCOP Domain Sequences for d1nqaq2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nqaq2 d.81.1.1 (Q:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} attnclapfakvlheqfgivrgmmttvhsytndqrildlphkdlrraraaaesiiptttg aakavalvlpelkgklngmamrvptpnvsvvdlvaelekevtveevnaalkaaaegelkg ilayseeplvsrdyngstvsstidalstmvidgkmvkvvswyd
Timeline for d1nqaq2: