Lineage for d1nqaq2 (1nqa Q:149-312)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 727888Fold d.81: FwdE/GAPDH domain-like [55346] (3 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 727889Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 727890Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 727944Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)
  7. 727965Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [55351] (10 PDB entries)
  8. 727988Domain d1nqaq2: 1nqa Q:149-312 [86021]
    Other proteins in same PDB: d1nqao1, d1nqap1, d1nqaq1, d1nqar1

Details for d1nqaq2

PDB Entry: 1nqa (more details), 2.2 Å

PDB Description: glyceraldehyde-3-phosphate dehydrogenase mutant with cys 149 replaced by ala complexed with nad+ and d-glyceraldehyde-3-phosphate
PDB Compounds: (Q:) glyceraldehyde 3-phosphate dehydrogenase

SCOP Domain Sequences for d1nqaq2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nqaq2 d.81.1.1 (Q:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]}
attnclapfakvlheqfgivrgmmttvhsytndqrildlphkdlrraraaaesiiptttg
aakavalvlpelkgklngmamrvptpnvsvvdlvaelekevtveevnaalkaaaegelkg
ilayseeplvsrdyngstvsstidalstmvidgkmvkvvswyd

SCOP Domain Coordinates for d1nqaq2:

Click to download the PDB-style file with coordinates for d1nqaq2.
(The format of our PDB-style files is described here.)

Timeline for d1nqaq2: