SCOPe 2.06: Domain d1nqao1: 1nqa O:0-148,O:313-333

Lineage for d1nqao1 (1nqa O:0-148,O:313-333)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (20 species)

7. Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [51803] (11 PDB entries)

8. Domain d1nqao1: 1nqa O:0-148,O:313-333 [86016]
   Other proteins in same PDB: d1nqao2, d1nqap2, d1nqaq2, d1nqar2
   complexed with g3h, nad; mutant

Details for d1nqao1

PDB Entry: 1nqa, 2.2 Å

PDB Description: glyceraldehyde-3-phosphate dehydrogenase mutant with cys 149 replaced by ala complexed with nad+ and d-glyceraldehyde-3-phosphate

PDB Compounds: (O:) glyceraldehyde 3-phosphate dehydrogenase

SCOPe Domain Sequences for d1nqao1:

Sequence; same for both SEQRES and ATOM records:

>d1nqao1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]}
avkvgingfgrigrnvfraalknpdievvavndltdantlahllkydsvhgrldaevsvn
gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
pakneditivmgvnqdkydpkahhvisnasXnetgyshrvvdlaayiaskgl

Timeline for d1nqao1:

• d1nqao1 first appeared in SCOP 1.65
  
• d1nqao1 appears in SCOPe 2.05
  
• d1nqao1 appears in SCOPe 2.07
  
• d1nqao1 appears in the current release, SCOPe 2.08