Lineage for d1nq5o1 (1nq5 O:0-148,O:313-333)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2104791Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2105032Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (20 species)
  7. 2105043Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [51803] (11 PDB entries)
  8. 2105062Domain d1nq5o1: 1nq5 O:0-148,O:313-333 [86012]
    Other proteins in same PDB: d1nq5a2, d1nq5c2, d1nq5o2, d1nq5q2
    complexed with nad, so4; mutant

Details for d1nq5o1

PDB Entry: 1nq5 (more details), 2.11 Å

PDB Description: glyceraldehyde-3-phosphate dehydrogenase mutant with cys 149 replaced by ser complexed with nad+
PDB Compounds: (O:) glyceraldehyde 3-phosphate dehydrogenase

SCOPe Domain Sequences for d1nq5o1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nq5o1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]}
avkvgingfgrigrnvfraalknpdievvavndltdantlahllkydsvhgrldaevsvn
gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
pakneditivmgvnqdkydpkahhvisnasXnetgyshrvvdlaayiaskgl

SCOPe Domain Coordinates for d1nq5o1:

Click to download the PDB-style file with coordinates for d1nq5o1.
(The format of our PDB-style files is described here.)

Timeline for d1nq5o1: