SCOPe 2.03: Domain d1nptr2: 1npt R:149-312

Lineage for d1nptr2 (1npt R:149-312)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (6 proteins)
   has many additional secondary structures

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)

7. Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [55351] (11 PDB entries)

8. Domain d1nptr2: 1npt R:149-312 [85994]
   Other proteins in same PDB: d1npto1, d1nptp1, d1nptq1, d1nptr1
   complexed with nad, so4; mutant

Details for d1nptr2

PDB Entry: 1npt, 2.18 Å

PDB Description: glyceraldehyde-3-phosphate dehydrogenase mutant with cys 149 replaced by ala complexed with nad+

PDB Compounds: (R:) glyceraldehyde 3-phosphate dehydrogenase

SCOPe Domain Sequences for d1nptr2:

Sequence; same for both SEQRES and ATOM records:

>d1nptr2 d.81.1.1 (R:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]}
attnclapfakvlheqfgivrgmmttvhsytndqrildlphkdlrraraaaesiiptttg
aakavalvlpelkgklngmamrvptpnvsvvdlvaelekevtveevnaalkaaaegelkg
ilayseeplvsrdyngstvsstidalstmvidgkmvkvvswyd

Timeline for d1nptr2:

• d1nptr2 first appeared in SCOP 1.65
  
• d1nptr2 appears in SCOPe 2.02
  
• d1nptr2 appears in SCOPe 2.04
  
• d1nptr2 appears in the current release, SCOPe 2.08