![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) ![]() contains similar fold but lacks its catalytic centre |
![]() | Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (4 proteins) family GH20 |
![]() | Protein beta-hexosaminidase B, N-terminal domain [89992] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89993] (6 PDB entries) |
![]() | Domain d1nowb2: 1now B:55-199 [85939] Other proteins in same PDB: d1nowa1, d1nowb1 complexed with gol, ifg, so4 |
PDB Entry: 1now (more details), 2.2 Å
SCOPe Domain Sequences for d1nowb2:
Sequence, based on SEQRES records: (download)
>d1nowb2 d.92.2.1 (B:55-199) beta-hexosaminidase B, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} alwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgfykwhhe paefqaktqvqqllvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrglet fsqlvyqdsygtftinestiidspr
>d1nowb2 d.92.2.1 (B:55-199) beta-hexosaminidase B, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} alwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgtqvqqll vsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgletfsqlvyqdsygtft inestiidspr
Timeline for d1nowb2: