SCOP 1.69: Domain d1noga_: 1nog A:

Lineage for d1noga_ (1nog A:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.25: Ferritin-like [47239] (2 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (2 families)
   crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site

5. Family a.25.2.2: Cobalamin adenosyltransferase [89032] (2 proteins)

6. Protein Hypothetical protein Ta0546 [89033] (1 species)

7. Species Archaeon Thermoplasma acidophilum [TaxId:2303] [89034] (1 PDB entry)

8. Domain d1noga_: 1nog A: [85923]
   structural genomics

Details for d1noga_

PDB Entry: 1nog, 1.55 Å

PDB Description: Crystal Structure of Conserved Protein 0546 from Thermoplasma Acidophilum

SCOP Domain Sequences for d1noga_:

Sequence; same for both SEQRES and ATOM records:

>d1noga_ a.25.2.2 (A:) Hypothetical protein Ta0546 {Archaeon Thermoplasma acidophilum}
spvvevqgtidelnsfigyalvlsrwddirndlfriqndlfvlgedvstggkgrtvtrem
idylearvkemkaeigkielfvvpggsvesaslhmaravsrrlerrivaasklteinknv
liyanrlssilfmhalisnkrlnipekiw

Timeline for d1noga_:

• d1noga_ first appeared in SCOP 1.65
  
• d1noga_ appears in SCOP 1.67
  
• d1noga_ appears in SCOP 1.71
  
• d1noga_ appears in the current release, SCOPe 2.08