![]() | Class a: All alpha proteins [46456] (179 folds) |
![]() | Fold a.25: Ferritin-like [47239] (2 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.2: Thermoplasma ferritin-like 4-helical bundle [89028] (2 families) ![]() crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site |
![]() | Family a.25.2.2: Hypothetical protein Ta0546 [89032] (1 protein) |
![]() | Protein Hypothetical protein Ta0546 [89033] (1 species) |
![]() | Species Archaeon Thermoplasma acidophilum [TaxId:2303] [89034] (1 PDB entry) |
![]() | Domain d1noga_: 1nog A: [85923] structural genomics |
PDB Entry: 1nog (more details), 1.55 Å
SCOP Domain Sequences for d1noga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1noga_ a.25.2.2 (A:) Hypothetical protein Ta0546 {Archaeon Thermoplasma acidophilum} spvvevqgtidelnsfigyalvlsrwddirndlfriqndlfvlgedvstggkgrtvtrem idylearvkemkaeigkielfvvpggsvesaslhmaravsrrlerrivaasklteinknv liyanrlssilfmhalisnkrlnipekiw
Timeline for d1noga_: