Lineage for d1noga_ (1nog A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2705262Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families) (S)
    crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site
  5. 2705267Family a.25.2.2: Cobalamin adenosyltransferase [89032] (3 proteins)
    automatically mapped to Pfam PF01923
  6. 2705268Protein Hypothetical protein Ta0546 [89033] (1 species)
  7. 2705269Species Thermoplasma acidophilum [TaxId:2303] [89034] (1 PDB entry)
  8. 2705270Domain d1noga_: 1nog A: [85923]
    structural genomics

Details for d1noga_

PDB Entry: 1nog (more details), 1.55 Å

PDB Description: Crystal Structure of Conserved Protein 0546 from Thermoplasma Acidophilum
PDB Compounds: (A:) conserved hypothetical protein TA0546

SCOPe Domain Sequences for d1noga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1noga_ a.25.2.2 (A:) Hypothetical protein Ta0546 {Thermoplasma acidophilum [TaxId: 2303]}
spvvevqgtidelnsfigyalvlsrwddirndlfriqndlfvlgedvstggkgrtvtrem
idylearvkemkaeigkielfvvpggsvesaslhmaravsrrlerrivaasklteinknv
liyanrlssilfmhalisnkrlnipekiw

SCOPe Domain Coordinates for d1noga_:

Click to download the PDB-style file with coordinates for d1noga_.
(The format of our PDB-style files is described here.)

Timeline for d1noga_: