Lineage for d1nneb4 (1nne B:1001-1120)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 865422Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
    beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 865453Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (1 family) (S)
  5. 865454Family d.75.2.1: DNA repair protein MutS, domain I [55272] (1 protein)
  6. 865455Protein DNA repair protein MutS, domain I [55273] (2 species)
  7. 865474Species Thermus aquaticus [TaxId:271] [55274] (3 PDB entries)
  8. 865480Domain d1nneb4: 1nne B:1001-1120 [85902]
    Other proteins in same PDB: d1nnea1, d1nnea2, d1nnea3, d1nneb1, d1nneb2, d1nneb3
    complexed with adp, bef, edo, so4

Details for d1nneb4

PDB Entry: 1nne (more details), 3.11 Å

PDB Description: Crystal Structure of the MutS-ADPBeF3-DNA complex
PDB Compounds: (B:) DNA mismatch repair protein muts

SCOP Domain Sequences for d1nneb4:

Sequence, based on SEQRES records: (download)

>d1nneb4 d.75.2.1 (B:1001-1120) DNA repair protein MutS, domain I {Thermus aquaticus [TaxId: 271]}
megmlkgegpgplppllqqyvelrdqypdylllfqvgdfyecfgedaerlaralglvlth
ktskdfttpmagiplrafeayaerllkmgfrlavadqvepaeeaeglvrrevtqlltpgt

Sequence, based on observed residues (ATOM records): (download)

>d1nneb4 d.75.2.1 (B:1001-1120) DNA repair protein MutS, domain I {Thermus aquaticus [TaxId: 271]}
megmlkgegpgplppllqqyvelrdqypdylllfqvgdfyecfgedaerlaralglvlth
ktskdfttpmagiplrafeayaerllkmgfrlavadqveplvrrevtqlltpgt

SCOP Domain Coordinates for d1nneb4:

Click to download the PDB-style file with coordinates for d1nneb4.
(The format of our PDB-style files is described here.)

Timeline for d1nneb4: