Lineage for d1nneb2 (1nne B:1542-1765)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 313180Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 313181Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) (S)
    division into families based on beta-sheet topologies
  5. 314354Family c.37.1.12: ABC transporter ATPase domain-like [52686] (14 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 314368Protein DNA repair protein MutS, the C-terminal domain [52697] (2 species)
  7. 314374Species Thermus aquaticus [TaxId:271] [52698] (4 PDB entries)
  8. 314380Domain d1nneb2: 1nne B:1542-1765 [85900]
    Other proteins in same PDB: d1nnea1, d1nnea3, d1nnea4, d1nneb1, d1nneb3, d1nneb4
    complexed with adp, bef, edo, so4

Details for d1nneb2

PDB Entry: 1nne (more details), 3.11 Å

PDB Description: Crystal Structure of the MutS-ADPBeF3-DNA complex

SCOP Domain Sequences for d1nneb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nneb2 c.37.1.12 (B:1542-1765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus}
yvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtalial
laqvgsfvpaeeahlplfdgiytrigasddlaggkstfmvemeevalilkeatenslvll
devgrgtssldgvaiatavaealherraytlfathyfeltalglprlknlhvaareeagg
lvfyhqvlpgpasksygvevaamaglpkevvararallqamaar

SCOP Domain Coordinates for d1nneb2:

Click to download the PDB-style file with coordinates for d1nneb2.
(The format of our PDB-style files is described here.)

Timeline for d1nneb2: