Lineage for d1nneb1 (1nne B:1267-1541)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338214Fold a.113: DNA repair protein MutS, domain III [48333] (1 superfamily)
    multihelical; consists of 2 all-alpha subdomains
  4. 2338215Superfamily a.113.1: DNA repair protein MutS, domain III [48334] (2 families) (S)
  5. 2338216Family a.113.1.1: DNA repair protein MutS, domain III [48335] (1 protein)
  6. 2338217Protein DNA repair protein MutS, domain III [48336] (2 species)
  7. 2338234Species Thermus aquaticus [TaxId:271] [48337] (4 PDB entries)
  8. 2338240Domain d1nneb1: 1nne B:1267-1541 [85899]
    Other proteins in same PDB: d1nnea2, d1nnea3, d1nnea4, d1nneb2, d1nneb3, d1nneb4
    protein/DNA complex; complexed with adp, bef, edo, so4

Details for d1nneb1

PDB Entry: 1nne (more details), 3.11 Å

PDB Description: Crystal Structure of the MutS-ADPBeF3-DNA complex
PDB Compounds: (B:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1nneb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nneb1 a.113.1.1 (B:1267-1541) DNA repair protein MutS, domain III {Thermus aquaticus [TaxId: 271]}
rgqdtlfsvldetrtapgrrllqswlrhplldrgplearldrvegfvregalregvrrll
yrladlerlatrlelgraspkdlgalrrslqilpelrallgeevglpdlsplkeeleaal
vedpplkvseggliregydpdldalraahregvayfleleererertgiptlkvgynavf
gyylevtrpyyervpkeyrpvqtlkdrqrytlpemkekerevyrlealirrreeevflev
rerakrqaealreaarilaeldvyaalaevavryg

SCOPe Domain Coordinates for d1nneb1:

Click to download the PDB-style file with coordinates for d1nneb1.
(The format of our PDB-style files is described here.)

Timeline for d1nneb1: