Lineage for d1nneb1 (1nne B:1267-1541)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775145Fold a.113: DNA repair protein MutS, domain III [48333] (1 superfamily)
    multihelical; consists of 2 all-alpha subdomains
  4. 775146Superfamily a.113.1: DNA repair protein MutS, domain III [48334] (1 family) (S)
  5. 775147Family a.113.1.1: DNA repair protein MutS, domain III [48335] (1 protein)
  6. 775148Protein DNA repair protein MutS, domain III [48336] (2 species)
  7. 775167Species Thermus aquaticus [TaxId:271] [48337] (4 PDB entries)
  8. 775173Domain d1nneb1: 1nne B:1267-1541 [85899]
    Other proteins in same PDB: d1nnea2, d1nnea3, d1nnea4, d1nneb2, d1nneb3, d1nneb4
    complexed with adp, bef, edo, so4

Details for d1nneb1

PDB Entry: 1nne (more details), 3.11 Å

PDB Description: Crystal Structure of the MutS-ADPBeF3-DNA complex
PDB Compounds: (B:) DNA mismatch repair protein muts

SCOP Domain Sequences for d1nneb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nneb1 a.113.1.1 (B:1267-1541) DNA repair protein MutS, domain III {Thermus aquaticus [TaxId: 271]}
rgqdtlfsvldetrtapgrrllqswlrhplldrgplearldrvegfvregalregvrrll
yrladlerlatrlelgraspkdlgalrrslqilpelrallgeevglpdlsplkeeleaal
vedpplkvseggliregydpdldalraahregvayfleleererertgiptlkvgynavf
gyylevtrpyyervpkeyrpvqtlkdrqrytlpemkekerevyrlealirrreeevflev
rerakrqaealreaarilaeldvyaalaevavryg

SCOP Domain Coordinates for d1nneb1:

Click to download the PDB-style file with coordinates for d1nneb1.
(The format of our PDB-style files is described here.)

Timeline for d1nneb1: