Lineage for d1nnea4 (1nne A:1-120)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1913772Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
    beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 1913803Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (2 families) (S)
    automatically mapped to Pfam PF01624
  5. 1913804Family d.75.2.1: DNA repair protein MutS, domain I [55272] (1 protein)
  6. 1913805Protein DNA repair protein MutS, domain I [55273] (2 species)
  7. 1913822Species Thermus aquaticus [TaxId:271] [55274] (3 PDB entries)
  8. 1913827Domain d1nnea4: 1nne A:1-120 [85898]
    Other proteins in same PDB: d1nnea1, d1nnea2, d1nnea3, d1nneb1, d1nneb2, d1nneb3
    protein/DNA complex; complexed with adp, bef, edo, so4

Details for d1nnea4

PDB Entry: 1nne (more details), 3.11 Å

PDB Description: Crystal Structure of the MutS-ADPBeF3-DNA complex
PDB Compounds: (A:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1nnea4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nnea4 d.75.2.1 (A:1-120) DNA repair protein MutS, domain I {Thermus aquaticus [TaxId: 271]}
megmlkgegpgplppllqqyvelrdqypdylllfqvgdfyecfgedaerlaralglvlth
ktskdfttpmagiplrafeayaerllkmgfrlavadqvepaeeaeglvrrevtqlltpgt

SCOPe Domain Coordinates for d1nnea4:

Click to download the PDB-style file with coordinates for d1nnea4.
(The format of our PDB-style files is described here.)

Timeline for d1nnea4: