| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.6: DNA repair protein MutS, domain II [53150] (1 family) ![]() |
| Family c.55.6.1: DNA repair protein MutS, domain II [53151] (1 protein) |
| Protein DNA repair protein MutS, domain II [53152] (2 species) |
| Species Thermus aquaticus [TaxId:271] [53153] (4 PDB entries) |
| Domain d1nnea3: 1nne A:121-266 [85897] Other proteins in same PDB: d1nnea1, d1nnea2, d1nnea4, d1nneb1, d1nneb2, d1nneb4 |
PDB Entry: 1nne (more details), 3.11 Å
SCOP Domain Sequences for d1nnea3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nnea3 c.55.6.1 (A:121-266) DNA repair protein MutS, domain II {Thermus aquaticus [TaxId: 271]}
llqesllpreanylaaiatgdgwglafldvstgefkgtvlksksalydelfrhrpaevll
apellengafldefrkrfpvmlseapfepegegplalrrargallayaqrtqggalslqp
frfydpgafmrlpeatlralevfepl
Timeline for d1nnea3:
View in 3DDomains from other chains: (mouse over for more information) d1nneb1, d1nneb2, d1nneb3, d1nneb4 |