Lineage for d1nnea2 (1nne A:542-765)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 583025Family c.37.1.12: ABC transporter ATPase domain-like [52686] (19 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 583076Protein DNA repair protein MutS, the C-terminal domain [52697] (2 species)
  7. 583092Species Thermus aquaticus [TaxId:271] [52698] (4 PDB entries)
  8. 583097Domain d1nnea2: 1nne A:542-765 [85896]
    Other proteins in same PDB: d1nnea1, d1nnea3, d1nnea4, d1nneb1, d1nneb3, d1nneb4

Details for d1nnea2

PDB Entry: 1nne (more details), 3.11 Å

PDB Description: Crystal Structure of the MutS-ADPBeF3-DNA complex

SCOP Domain Sequences for d1nnea2:

Sequence, based on SEQRES records: (download)

>d1nnea2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus}
yvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtalial
laqvgsfvpaeeahlplfdgiytrigasddlaggkstfmvemeevalilkeatenslvll
devgrgtssldgvaiatavaealherraytlfathyfeltalglprlknlhvaareeagg
lvfyhqvlpgpasksygvevaamaglpkevvararallqamaar

Sequence, based on observed residues (ATOM records): (download)

>d1nnea2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus}
yvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtalial
laqvgsfvpaeeahlplfdgiytrigagkstfmvemeevalilkeatenslvlldevgrg
tssldgvaiatavaealherraytlfathyfeltalglprlknlhvaareeagglvfyhq
vlpgpasksygvevaamaglpkevvararallqamaar

SCOP Domain Coordinates for d1nnea2:

Click to download the PDB-style file with coordinates for d1nnea2.
(The format of our PDB-style files is described here.)

Timeline for d1nnea2: