Lineage for d1nkoa_ (1nko A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2741819Protein N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) [89176] (1 species)
  7. 2741820Species Human (Homo sapiens) [TaxId:9606] [89177] (6 PDB entries)
  8. 2741821Domain d1nkoa_: 1nko A: [85829]

Details for d1nkoa_

PDB Entry: 1nko (more details), 1.45 Å

PDB Description: energetic and structural basis of sialylated oligosaccharide recognition by the natural killer cell inhibitory receptor p75/airm1 or siglec-7
PDB Compounds: (A:) Sialic acid binding Ig-like lectin 7

SCOPe Domain Sequences for d1nkoa_:

Sequence, based on SEQRES records: (download)

>d1nkoa_ b.1.1.1 (A:) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]}
snrkdysltmqssvtvqegmcvhvrcsfsypvdsdtdsdpvhgywfragndiswkapvat
nnpawavqeetrdrfhllgdpqtknctlsirdarmsdagryffrmekgnikwnykydqls
vnvtalt

Sequence, based on observed residues (ATOM records): (download)

>d1nkoa_ b.1.1.1 (A:) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]}
snrkdysltmqssvtvqegmcvhvrcsfsypvdsdtdsdpvhgywfrawkapvatnnpaw
avqeetrdrfhllgdpqtknctlsirdarmsdagryffrmekgnikwnykydqlsvnvta
lt

SCOPe Domain Coordinates for d1nkoa_:

Click to download the PDB-style file with coordinates for d1nkoa_.
(The format of our PDB-style files is described here.)

Timeline for d1nkoa_: