Lineage for d1njsa_ (1njs A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500328Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 2500329Superfamily c.65.1: Formyltransferase [53328] (2 families) (S)
  5. 2500330Family c.65.1.1: Formyltransferase [53329] (5 proteins)
  6. 2500337Protein Glycinamide ribonucleotide transformylase, GART [53330] (2 species)
  7. 2500359Species Human (Homo sapiens) [TaxId:9606] [82468] (30 PDB entries)
  8. 2500373Domain d1njsa_: 1njs A: [85823]
    complexed with keu, po4

Details for d1njsa_

PDB Entry: 1njs (more details), 1.98 Å

PDB Description: human GAR Tfase in complex with hydrolyzed form of 10-trifluoroacetyl-5,10-dideaza-acyclic-5,6,7,8-tetrahydrofolic acid
PDB Compounds: (A:) phosphoribosylglycinamide formyltransferase

SCOPe Domain Sequences for d1njsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1njsa_ c.65.1.1 (A:) Glycinamide ribonucleotide transformylase, GART {Human (Homo sapiens) [TaxId: 9606]}
arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
lqlvasgtvqlgengkicwv

SCOPe Domain Coordinates for d1njsa_:

Click to download the PDB-style file with coordinates for d1njsa_.
(The format of our PDB-style files is described here.)

Timeline for d1njsa_: