Lineage for d1njix_ (1nji X:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 726215Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
    core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold
  4. 726216Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family) (S)
  5. 726217Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)
  6. 726218Protein Archaeal L30 (L30a) [55133] (1 species)
    long-chain member of the family; contains additional C-terminal (sub)domain
  7. 726219Species Archaeon Haloarcula marismortui [TaxId:2238] [55134] (40 PDB entries)
  8. 726239Domain d1njix_: 1nji X: [85815]
    Other proteins in same PDB: d1nji1_, d1nji2_, d1nji3_, d1nji4_, d1njic1, d1njic2, d1njid_, d1njie_, d1njif_, d1njig1, d1njig2, d1njih_, d1njii_, d1njij_, d1njik_, d1njil_, d1njim_, d1njin_, d1njio_, d1njip_, d1njiq_, d1njir_, d1njis_, d1njit_, d1njiu_, d1njiv_, d1njiw_, d1njiy_, d1njiz_
    complexed with cd, cl, clm, k, mg, na; mutant

Details for d1njix_

PDB Entry: 1nji (more details), 3 Å

PDB Description: Structure of chloramphenicol bound to the 50S ribosomal subunit
PDB Compounds: (X:) 50S ribosomal protein L30P

SCOP Domain Sequences for d1njix_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1njix_ d.59.1.1 (X:) Archaeal L30 (L30a) {Archaeon Haloarcula marismortui [TaxId: 2238]}
mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
prgghdgvkhpvkeggqlgkhdtegiddlleamr

SCOP Domain Coordinates for d1njix_:

Click to download the PDB-style file with coordinates for d1njix_.
(The format of our PDB-style files is described here.)

Timeline for d1njix_: