SCOP 1.75: Domain d1njit_: 1nji T:

Lineage for d1njit_ (1nji T:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
   beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243

4. Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families)

5. Family d.12.1.1: L23p [54190] (1 protein)

6. Protein Ribosomal protein L23 [54191] (4 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [54192] (62 PDB entries)
   Uniprot P12732

8. Domain d1njit_: 1nji T: [85811]
   Other proteins in same PDB: d1nji1_, d1nji2_, d1nji3_, d1nji4_, d1njic1, d1njic2, d1njid_, d1njie_, d1njif_, d1njig1, d1njig2, d1njih_, d1njii_, d1njij_, d1njik_, d1njil_, d1njim_, d1njin_, d1njio_, d1njip_, d1njiq_, d1njir_, d1njis_, d1njiu_, d1njiv_, d1njiw_, d1njix_, d1njiy_, d1njiz_
   complexed with cd, cl, clm, k, mg, na; mutant

Details for d1njit_

PDB Entry: 1nji, 3 Å

PDB Description: Structure of chloramphenicol bound to the 50S ribosomal subunit

PDB Compounds: (T:) 50S ribosomal protein L23P

SCOP Domain Sequences for d1njit_:

Sequence; same for both SEQRES and ATOM records:

>d1njit_ d.12.1.1 (T:) Ribosomal protein L23 {Archaeon Haloarcula marismortui [TaxId: 2238]}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqevasri

Timeline for d1njit_:

• d1njit_ first appeared in SCOP 1.65
  
• d1njit_ appears in SCOP 1.73
  
• d1njit_ appears in SCOPe 2.01
  
• d1njit_ appears in the current release, SCOPe 2.08