Lineage for d1njik_ (1nji K:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825308Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214
  4. 825309Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) (S)
  5. 825310Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)
  6. 825311Protein Ribosomal protein L13 [52163] (5 species)
    synonym: 50S ribosomal protein L13p, HMAL13
  7. 825312Species Archaeon Haloarcula marismortui [TaxId:2238] [52164] (44 PDB entries)
    Uniprot P29198
  8. 825334Domain d1njik_: 1nji K: [85802]
    Other proteins in same PDB: d1nji1_, d1nji2_, d1nji3_, d1nji4_, d1njic1, d1njic2, d1njid_, d1njie_, d1njif_, d1njig1, d1njig2, d1njih_, d1njii_, d1njij_, d1njil_, d1njim_, d1njin_, d1njio_, d1njip_, d1njiq_, d1njir_, d1njis_, d1njit_, d1njiu_, d1njiv_, d1njiw_, d1njix_, d1njiy_, d1njiz_
    complexed with cd, cl, clm, k, mg, na; mutant

Details for d1njik_

PDB Entry: 1nji (more details), 3 Å

PDB Description: Structure of chloramphenicol bound to the 50S ribosomal subunit
PDB Compounds: (K:) 50S ribosomal protein L13P

SCOP Domain Sequences for d1njik_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1njik_ c.21.1.1 (K:) Ribosomal protein L13 {Archaeon Haloarcula marismortui [TaxId: 2238]}
aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr
lsnikfvtlgeisetlganktw

SCOP Domain Coordinates for d1njik_:

Click to download the PDB-style file with coordinates for d1njik_.
(The format of our PDB-style files is described here.)

Timeline for d1njik_: