Lineage for d1njih_ (1nji H:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 865651Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 865875Superfamily d.79.3: L30e-like [55315] (3 families) (S)
  5. 865876Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)
  6. 865893Protein Ribosomal protein L7ae [55319] (7 species)
  7. 865899Species Archaeon Haloarcula marismortui [TaxId:2238] [55320] (58 PDB entries)
    Uniprot P12743
  8. 865934Domain d1njih_: 1nji H: [85799]
    Other proteins in same PDB: d1nji1_, d1nji2_, d1nji3_, d1nji4_, d1njic1, d1njic2, d1njid_, d1njie_, d1njif_, d1njig1, d1njig2, d1njii_, d1njij_, d1njik_, d1njil_, d1njim_, d1njin_, d1njio_, d1njip_, d1njiq_, d1njir_, d1njis_, d1njit_, d1njiu_, d1njiv_, d1njiw_, d1njix_, d1njiy_, d1njiz_
    complexed with cd, cl, clm, k, mg, na; mutant

Details for d1njih_

PDB Entry: 1nji (more details), 3 Å

PDB Description: Structure of chloramphenicol bound to the 50S ribosomal subunit
PDB Compounds: (H:) 50S ribosomal protein L7Ae

SCOP Domain Sequences for d1njih_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1njih_ d.79.3.1 (H:) Ribosomal protein L7ae {Archaeon Haloarcula marismortui [TaxId: 2238]}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdagaaatvleeiadkveelr

SCOP Domain Coordinates for d1njih_:

Click to download the PDB-style file with coordinates for d1njih_.
(The format of our PDB-style files is described here.)

Timeline for d1njih_: