Lineage for d1njig2 (1nji G:80-172)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734251Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 734252Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
  5. 734253Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 734254Protein Ribosomal protein L6 [56055] (2 species)
    duplication: consists of two domains of this fold
  7. 734255Species Archaeon Haloarcula marismortui [TaxId:2238] [56057] (40 PDB entries)
  8. 734295Domain d1njig2: 1nji G:80-172 [85798]
    Other proteins in same PDB: d1nji1_, d1nji2_, d1nji3_, d1nji4_, d1njic1, d1njic2, d1njid_, d1njie_, d1njif_, d1njih_, d1njii_, d1njij_, d1njik_, d1njil_, d1njim_, d1njin_, d1njio_, d1njip_, d1njiq_, d1njir_, d1njis_, d1njit_, d1njiu_, d1njiv_, d1njiw_, d1njix_, d1njiy_, d1njiz_
    complexed with cd, cl, clm, k, mg, na; mutant

Details for d1njig2

PDB Entry: 1nji (more details), 3 Å

PDB Description: Structure of chloramphenicol bound to the 50S ribosomal subunit
PDB Compounds: (G:) 50S ribosomal protein L6P

SCOP Domain Sequences for d1njig2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1njig2 d.141.1.1 (G:80-172) Ribosomal protein L6 {Archaeon Haloarcula marismortui [TaxId: 2238]}
weygmevfyshfpmqvnvegdevvienflgekaprrttihgdtdveidgeeltvsgpdie
avgqtaadieqltrindkdvrvfqdgvyitrkp

SCOP Domain Coordinates for d1njig2:

Click to download the PDB-style file with coordinates for d1njig2.
(The format of our PDB-style files is described here.)

Timeline for d1njig2: