Lineage for d1njie_ (1nji E:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825407Fold c.22: Ribosomal protein L4 [52165] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423
  4. 825408Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family) (S)
  5. 825409Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein)
  6. 825410Protein Ribosomal protein L4 [52168] (5 species)
    synonym: 50S ribosomal protein L4e, HMAL4, HL6
  7. 825411Species Archaeon Haloarcula marismortui [TaxId:2238] [52170] (46 PDB entries)
    Uniprot P12735
  8. 825433Domain d1njie_: 1nji E: [85795]
    Other proteins in same PDB: d1nji1_, d1nji2_, d1nji3_, d1nji4_, d1njic1, d1njic2, d1njid_, d1njif_, d1njig1, d1njig2, d1njih_, d1njii_, d1njij_, d1njik_, d1njil_, d1njim_, d1njin_, d1njio_, d1njip_, d1njiq_, d1njir_, d1njis_, d1njit_, d1njiu_, d1njiv_, d1njiw_, d1njix_, d1njiy_, d1njiz_
    complexed with cd, cl, clm, k, mg, na; mutant

Details for d1njie_

PDB Entry: 1nji (more details), 3 Å

PDB Description: Structure of chloramphenicol bound to the 50S ribosomal subunit
PDB Compounds: (E:) 50S ribosomal protein L4E

SCOP Domain Sequences for d1njie_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1njie_ c.22.1.1 (E:) Ribosomal protein L4 {Archaeon Haloarcula marismortui [TaxId: 2238]}
mqatiydldgntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaes
fgsgrgqahvpkldgrarrvpqavkgrsahppktekdrsldlndkerqlavrsalaatad
adlvadrghefdrdevpvvvsddfedlvktqevvsllealdvhadidradetkikagqgs
argrkyrrpasilfvtsdepstaarnlagadvatasevntedlapggapgrltvftesal
aevaer

SCOP Domain Coordinates for d1njie_:

Click to download the PDB-style file with coordinates for d1njie_.
(The format of our PDB-style files is described here.)

Timeline for d1njie_: