Lineage for d1nj7a_ (1nj7 A:)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 344818Fold g.63: Mollusk pheromone [90182] (1 superfamily)
    disulphide-rich; all-alpha
  4. 344819Superfamily g.63.1: Mollusk pheromone [90183] (1 family) (S)
  5. 344820Family g.63.1.1: Mollusk pheromone [90184] (1 protein)
  6. 344821Protein Attractin [90185] (1 species)
  7. 344822Species California sea hare (Aplysia californica) [TaxId:6500] [90186] (1 PDB entry)
  8. 344823Domain d1nj7a_: 1nj7 A: [85768]

Details for d1nj7a_

PDB Entry: 1nj7 (more details)

PDB Description: nmr solution structure of aplysia attractin

SCOP Domain Sequences for d1nj7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nj7a_ g.63.1.1 (A:) Attractin {California sea hare (Aplysia californica)}
dqncdignitsqcqmqhkncedangcdtiieecktsmvercqnqefesaagsttlgpq

SCOP Domain Coordinates for d1nj7a_:

Click to download the PDB-style file with coordinates for d1nj7a_.
(The format of our PDB-style files is described here.)

Timeline for d1nj7a_:

  • d1nj7a_ is new in SCOP 1.65
  • d1nj7a_ became obsolete in SCOP 1.67