Lineage for d1ni6d_ (1ni6 D:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 286010Fold a.132: Heme oxygenase [48612] (1 superfamily)
    multihelical; bundle
  4. 286011Superfamily a.132.1: Heme oxygenase [48613] (2 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 286012Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (2 proteins)
  6. 286021Protein Heme oxygenase-1 (HO-1) [48615] (2 species)
  7. 286022Species Human (Homo sapiens) [TaxId:9606] [48616] (3 PDB entries)
  8. 286028Domain d1ni6d_: 1ni6 D: [85737]
    heme-free structure
    complexed with cl, tre

Details for d1ni6d_

PDB Entry: 1ni6 (more details), 2.1 Å

PDB Description: comparisions of the heme-free and-bound crystal structures of human heme oxygenase-1

SCOP Domain Sequences for d1ni6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ni6d_ a.132.1.1 (D:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens)}
qdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernke
spvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepellv
ahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsle
mtpavrqrvieeaktafllniqlfeelqellth

SCOP Domain Coordinates for d1ni6d_:

Click to download the PDB-style file with coordinates for d1ni6d_.
(The format of our PDB-style files is described here.)

Timeline for d1ni6d_: