Lineage for d1ni6a_ (1ni6 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1749970Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 1749971Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 1749972Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
    automatically mapped to Pfam PF01126
  6. 1750018Protein Heme oxygenase-1 (HO-1) [48615] (3 species)
  7. 1750019Species Human (Homo sapiens) [TaxId:9606] [48616] (24 PDB entries)
    Uniprot P09601
  8. 1750040Domain d1ni6a_: 1ni6 A: [85734]
    heme-free structure
    complexed with cl, tre

Details for d1ni6a_

PDB Entry: 1ni6 (more details), 2.1 Å

PDB Description: comparisions of the heme-free and-bound crystal structures of human heme oxygenase-1
PDB Compounds: (A:) Heme oxygenase 1

SCOPe Domain Sequences for d1ni6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ni6a_ a.132.1.1 (A:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellthd

SCOPe Domain Coordinates for d1ni6a_:

Click to download the PDB-style file with coordinates for d1ni6a_.
(The format of our PDB-style files is described here.)

Timeline for d1ni6a_: