Lineage for d1nhha2 (1nhh A:-2-216)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 610241Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 610242Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) (S)
  5. 610286Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (6 proteins)
  6. 610296Protein DNA mismatch repair protein MutL [55882] (1 species)
  7. 610297Species Escherichia coli [TaxId:562] [55883] (6 PDB entries)
  8. 610301Domain d1nhha2: 1nhh A:-2-216 [85717]
    Other proteins in same PDB: d1nhha1
    complexed with anp, edo, mg, rb

Details for d1nhha2

PDB Entry: 1nhh (more details), 2.4 Å

PDB Description: Crystal structure of N-terminal 40KD MutL protein (LN40) complex with ADPnP and one Rubidium

SCOP Domain Sequences for d1nhha2:

Sequence, based on SEQRES records: (download)

>d1nhha2 d.122.1.2 (A:-2-216) DNA mismatch repair protein MutL {Escherichia coli}
shmpiqvlppqlanqiaagevverpasvvkelvensldagatrididierggaklirird
ngcgikkdelalalarhatskiaslddleaiislgfrgealasissvsrltltsrtaeqq
eawqayaegrdmnvtvkpaahpvgttlevldlfyntparrkflrtektefnhideiirri
alarfdvtinlshngkivrqyravpeggqkerrlgaic

Sequence, based on observed residues (ATOM records): (download)

>d1nhha2 d.122.1.2 (A:-2-216) DNA mismatch repair protein MutL {Escherichia coli}
shmpiqvlppqlanqiaagevverpasvvkelvensldagatrididierggaklirird
ngcgikkdelalalarhatskiaslddleaiislgfrgealasissvsrltltsrtaeqq
eawqayaegrdmnvtvkpaahpvgttlevldlfyntparrkflrtektefnhideiirri
alarfdvtinlshngkivrqyravpqkerrlgaic

SCOP Domain Coordinates for d1nhha2:

Click to download the PDB-style file with coordinates for d1nhha2.
(The format of our PDB-style files is described here.)

Timeline for d1nhha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nhha1