SCOP 1.73: Domain d1nhha1: 1nhh A:217-331

Lineage for d1nhha1 (1nhh A:217-331)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families)

5. Family d.14.1.3: DNA gyrase/MutL, second domain [54224] (6 proteins)

6. Protein DNA mismatch repair protein MutL [54225] (1 species)

7. Species Escherichia coli [TaxId:562] [54226] (6 PDB entries)

8. Domain d1nhha1: 1nhh A:217-331 [85716]
   Other proteins in same PDB: d1nhha2
   complexed with anp, edo, mg, rb

Details for d1nhha1

PDB Entry: 1nhh, 2.4 Å

PDB Description: Crystal structure of N-terminal 40KD MutL protein (LN40) complex with ADPnP and one Rubidium

PDB Compounds: (A:) DNA mismatch repair protein mutL

SCOP Domain Sequences for d1nhha1:

Sequence, based on SEQRES records:

>d1nhha1 d.14.1.3 (A:217-331) DNA mismatch repair protein MutL {Escherichia coli [TaxId: 562]}
gtafleqalaiewqhgdltlrgwvadpnhttpalaeiqycyvngrmmrdrlinhairqac
edklgadqqpafvlyleidphqvdvnvhpakhevrfhqsrlvhdfiyqgvlsvlq

Sequence, based on observed residues (ATOM records):

>d1nhha1 d.14.1.3 (A:217-331) DNA mismatch repair protein MutL {Escherichia coli [TaxId: 562]}
gtafleqalaiewqhgdltlrgwvadpnhttpalaeiqycyvngrmmrdrlinhairqac
edklgqqpafvlyleidphqvdvnvhpakhevrfhqsrlvhdfiyqgvlsvlq

Timeline for d1nhha1:

• d1nhha1 first appeared in SCOP 1.65
  
• d1nhha1 appears in SCOP 1.71
  
• d1nhha1 appears in SCOP 1.75
  
• d1nhha1 appears in the current release, SCOPe 2.08