Lineage for d1nhha1 (1nhh A:217-331)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 598219Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 598220Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 598290Family d.14.1.3: DNA gyrase/MutL, second domain [54224] (6 proteins)
  6. 598298Protein DNA mismatch repair protein MutL [54225] (1 species)
  7. 598299Species Escherichia coli [TaxId:562] [54226] (6 PDB entries)
  8. 598303Domain d1nhha1: 1nhh A:217-331 [85716]
    Other proteins in same PDB: d1nhha2
    complexed with anp, edo, mg, rb

Details for d1nhha1

PDB Entry: 1nhh (more details), 2.4 Å

PDB Description: Crystal structure of N-terminal 40KD MutL protein (LN40) complex with ADPnP and one Rubidium

SCOP Domain Sequences for d1nhha1:

Sequence, based on SEQRES records: (download)

>d1nhha1 d.14.1.3 (A:217-331) DNA mismatch repair protein MutL {Escherichia coli}
gtafleqalaiewqhgdltlrgwvadpnhttpalaeiqycyvngrmmrdrlinhairqac
edklgadqqpafvlyleidphqvdvnvhpakhevrfhqsrlvhdfiyqgvlsvlq

Sequence, based on observed residues (ATOM records): (download)

>d1nhha1 d.14.1.3 (A:217-331) DNA mismatch repair protein MutL {Escherichia coli}
gtafleqalaiewqhgdltlrgwvadpnhttpalaeiqycyvngrmmrdrlinhairqac
edklgqqpafvlyleidphqvdvnvhpakhevrfhqsrlvhdfiyqgvlsvlq

SCOP Domain Coordinates for d1nhha1:

Click to download the PDB-style file with coordinates for d1nhha1.
(The format of our PDB-style files is described here.)

Timeline for d1nhha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nhha2