SCOP 1.75: Domain d1ngxl2: 1ngx L:108-213

Lineage for d1ngxl2 (1ngx L:108-213)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (132 PDB entries)
   SQ NA # humanized antibody
   Uniprot P01834 # KAC_HUMAN Ig kappa chain C region
   SQ P01834 # KAC_HUMAN Ig kappa chain C region.
   SQ NA # engineered antibody
   including humanized antibodies (chimeric proteins with human constant domains)
   SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

8. Domain d1ngxl2: 1ngx L:108-213 [85709]
   Other proteins in same PDB: d1ngxa1, d1ngxb1, d1ngxb2, d1ngxh1, d1ngxh2, d1ngxl1
   part of metal chelatase catalytic Fab 7G12; chimeric germline antibody
   complexed with jef

Details for d1ngxl2

PDB Entry: 1ngx, 1.8 Å

PDB Description: chimeric germline fab 7g12 with jeffamine fragment bound

PDB Compounds: (L:) Germline Metal Chelatase Catalytic Antibody, Light chain

SCOP Domain Sequences for d1ngxl2:

Sequence; same for both SEQRES and ATOM records:

>d1ngxl2 b.1.1.2 (L:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrne

Timeline for d1ngxl2:

• d1ngxl2 first appeared in SCOP 1.65
  
• d1ngxl2 appears in SCOP 1.73
  
• d1ngxl2 appears in SCOPe 2.01
  
• d1ngxl2 appears in the current release, SCOPe 2.08