SCOP 1.65: Domain d1ngxa2: 1ngx A:108-213

Lineage for d1ngxa2 (1ngx A:108-213)

Root: SCOP 1.65
Class b: All beta proteins [48724] (126 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
Species Human (Homo sapiens) [TaxId:9606] [88569] (62 PDB entries)
including humanized antibodies (chimeric proteins with human constant domains)
Domain d1ngxa2: 1ngx A:108-213 [85703]
Other proteins in same PDB: d1ngxa1, d1ngxb1, d1ngxb2, d1ngxh1, d1ngxh2, d1ngxl1

Details for d1ngxa2

PDB Entry: 1ngx (more details), 1.8 Å

PDB Description: chimeric germline fab 7g12 with jeffamine fragment bound

SCOP Domain Sequences for d1ngxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ngxa2 b.1.1.2 (A:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrne

SCOP Domain Coordinates for d1ngxa2:

Click to download the PDB-style file with coordinates for d1ngxa2.
(The format of our PDB-style files is described here.)

Timeline for d1ngxa2: