Lineage for d1ngva_ (1ngv A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 322817Fold c.111: Activating enzymes of the ubiquitin-like proteins [69571] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 32145678; strands 6 and 8 are antiparallel to the rest
  4. 322818Superfamily c.111.1: Activating enzymes of the ubiquitin-like proteins [69572] (2 families) (S)
    transfer adenylyl group to the C-terminal carboxyl group of the ubiquitin and MoaD/ThiS-related proteins
    the ATP nucleotide-binding site is similar to that of the NAD-binding Rossmann-folds
  5. 322825Family c.111.1.2: Ubiquitin activating enzymes (UBA) [89763] (2 proteins)
    the common fold is elaborated with additional (sub)domains
  6. 322826Protein Amyloid beta precursor protein-binding protein 1, APPBP1 [89766] (1 species)
    a subunit of the heterodimeric E1 enzyme for NEDD8; contains a large insertion (residues 170-487) that can be devided into 3 units similar to the UBA3 insertion
  7. 322827Species Human (Homo sapiens) [TaxId:9606] [89767] (1 PDB entry)
  8. 322828Domain d1ngva_: 1ngv A: [85698]
    Other proteins in same PDB: d1ngvb_, d1ngvd_

Details for d1ngva_

PDB Entry: 1ngv (more details), 2.6 Å

PDB Description: Insights into the ubiquitin transfer cascade from the structure of the E1 for NEDD8.

SCOP Domain Sequences for d1ngva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ngva_ c.111.1.2 (A:) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens)}
kllkeqkydrqlrlwgdhgqealesahvclinatatgteilknlvlpgigsftiidgnqv
sgedagnnfflqrssigknraeaameflqelnsdvsgsfveespenlldndpsffcrftv
vvatqlpestslrladvlwnsqipllicrtyglvgymriiikehpvieshpdnaledlrl
dkpfpelrehfqsydldhmekkdhshtpwiviiakylaqwysetngripktykekedfrd
lirqgilknengapedeenfeeaiknvntalnttqipssiedifnddrcinitkqtpsfw
ilaralkefvakegqgnlpvrgtipdmiadsgkyiklqnvyrekakkdaaavgnhvakll
qsigqapesisekelkllcsnsaflrvvrcrslaeeygldtinkdeiissmdnpdneivl
ylmlravdrfhkqqgrypgvsnyqveedigklkscltgflqeyglsvmvkddyvhefcry
gaaephtiaaflggaaaqevikiitkqfvifnntyiysgmsqtsatfql

SCOP Domain Coordinates for d1ngva_:

Click to download the PDB-style file with coordinates for d1ngva_.
(The format of our PDB-style files is described here.)

Timeline for d1ngva_: