Lineage for d1ngkk_ (1ngk K:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1074917Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1074918Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1074919Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins)
    lack the first helix (A)
  6. 1074920Protein Protozoan/bacterial hemoglobin [46460] (6 species)
  7. 1074946Species Mycobacterium tuberculosis, HbO [TaxId:1773] [88965] (2 PDB entries)
  8. 1074969Domain d1ngkk_: 1ngk K: [85683]
    complexed with cyn, hem, so4

Details for d1ngkk_

PDB Entry: 1ngk (more details), 2.11 Å

PDB Description: Crystallographic Structure of Mycobacterium tuberculosis Hemoglobin O
PDB Compounds: (K:) Hemoglobin-like protein HbO

SCOPe Domain Sequences for d1ngkk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ngkk_ a.1.1.1 (K:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbO [TaxId: 1773]}
pksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggprt
yseqrghprlrmrhapfrislierdawlrcmhtavasidsetlddehrrelldylemaah
slvnspf

SCOPe Domain Coordinates for d1ngkk_:

Click to download the PDB-style file with coordinates for d1ngkk_.
(The format of our PDB-style files is described here.)

Timeline for d1ngkk_: