Class a: All alpha proteins [46456] (202 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.1: Truncated hemoglobin [46459] (1 protein) lack the first helix (A) |
Protein Protozoan/bacterial hemoglobin [46460] (5 species) |
Species Mycobacterium tuberculosis, HbO [TaxId:1773] [88965] (1 PDB entry) |
Domain d1ngki_: 1ngk I: [85681] |
PDB Entry: 1ngk (more details), 2.11 Å
SCOP Domain Sequences for d1ngki_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ngki_ a.1.1.1 (I:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbO} pksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggprt yseqrghprlrmrhapfrislierdawlrcmhtavasidsetlddehrrelldylemaah slvnspf
Timeline for d1ngki_: