Lineage for d1nfvc_ (1nfv C:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 910725Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 910726Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 910727Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 910833Protein Bacterioferritin (cytochrome b1) [47244] (5 species)
    binds heme between two subunits; 24-mer
  7. 910836Species Desulfovibrio desulfuricans [TaxId:876] [89025] (3 PDB entries)
  8. 910855Domain d1nfvc_: 1nfv C: [85644]
    complexed with 3py, fe, fec, gol, so4

Details for d1nfvc_

PDB Entry: 1nfv (more details), 1.95 Å

PDB Description: x-ray structure of desulfovibrio desulfuricans bacterioferritin: the diiron centre in different catalytic states (as-isolated structure)
PDB Compounds: (C:) bacterioferritin

SCOPe Domain Sequences for d1nfvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfvc_ a.25.1.1 (C:) Bacterioferritin (cytochrome b1) {Desulfovibrio desulfuricans [TaxId: 876]}
gnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaen
faerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivta
rlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv

SCOPe Domain Coordinates for d1nfvc_:

Click to download the PDB-style file with coordinates for d1nfvc_.
(The format of our PDB-style files is described here.)

Timeline for d1nfvc_: