![]() | Class a: All alpha proteins [46456] (179 folds) |
![]() | Fold a.25: Ferritin-like [47239] (2 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (2 families) ![]() contains dimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (5 proteins) |
![]() | Protein Bacterioferritin (cytochrome b1) [47244] (3 species) binds haem between two subunits; 24-mer |
![]() | Species Desulfovibrio desulfuricans [TaxId:876] [89025] (3 PDB entries) |
![]() | Domain d1nfvc_: 1nfv C: [85644] |
PDB Entry: 1nfv (more details), 1.95 Å
SCOP Domain Sequences for d1nfvc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nfvc_ a.25.1.1 (C:) Bacterioferritin (cytochrome b1) {Desulfovibrio desulfuricans} gnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaen faerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivta rlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
Timeline for d1nfvc_: