| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (10 proteins) |
| Protein Bacterioferritin (cytochrome b1) [47244] (6 species) binds heme between two subunits; 24-mer |
| Species Desulfovibrio desulfuricans [TaxId:876] [89025] (3 PDB entries) |
| Domain d1nf6g_: 1nf6 G: [85620] complexed with fe, fec, gol, so4 |
PDB Entry: 1nf6 (more details), 2.35 Å
SCOPe Domain Sequences for d1nf6g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nf6g_ a.25.1.1 (G:) Bacterioferritin (cytochrome b1) {Desulfovibrio desulfuricans [TaxId: 876]}
nredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaenf
aerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivtar
lferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
Timeline for d1nf6g_: