| Class a: All alpha proteins [46456] (179 folds) |
| Fold a.25: Ferritin-like [47239] (2 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (2 families) ![]() contains dimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (5 proteins) |
| Protein Bacterioferritin (cytochrome b1) [47244] (3 species) binds haem between two subunits; 24-mer |
| Species Desulfovibrio desulfuricans [TaxId:876] [89025] (3 PDB entries) |
| Domain d1nf6f_: 1nf6 F: [85619] |
PDB Entry: 1nf6 (more details), 2.35 Å
SCOP Domain Sequences for d1nf6f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nf6f_ a.25.1.1 (F:) Bacterioferritin (cytochrome b1) {Desulfovibrio desulfuricans}
agnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhae
nfaerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivt
arlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
Timeline for d1nf6f_: