Lineage for d1nf6a_ (1nf6 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314152Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2314572Protein Bacterioferritin (cytochrome b1) [47244] (6 species)
    binds heme between two subunits; 24-mer
  7. 2314575Species Desulfovibrio desulfuricans [TaxId:876] [89025] (3 PDB entries)
  8. 2314592Domain d1nf6a_: 1nf6 A: [85614]
    complexed with fe, fec, gol, so4

Details for d1nf6a_

PDB Entry: 1nf6 (more details), 2.35 Å

PDB Description: x-ray structure of the desulfovibrio desulfuricans bacterioferritin: the diiron site in different catalytic states ("cycled" structure: reduced in solution and allowed to reoxidise before crystallisation)
PDB Compounds: (A:) bacterioferritin

SCOPe Domain Sequences for d1nf6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nf6a_ a.25.1.1 (A:) Bacterioferritin (cytochrome b1) {Desulfovibrio desulfuricans [TaxId: 876]}
gnredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaen
faerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivta
rlferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv

SCOPe Domain Coordinates for d1nf6a_:

Click to download the PDB-style file with coordinates for d1nf6a_.
(The format of our PDB-style files is described here.)

Timeline for d1nf6a_: