Lineage for d1nf4o_ (1nf4 O:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 279616Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 279617Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
    contains dimetal-ion centre in the middle of the bundle
  5. 279618Family a.25.1.1: Ferritin [47241] (5 proteins)
  6. 279669Protein Bacterioferritin (cytochrome b1) [47244] (3 species)
    binds haem between two subunits; 24-mer
  7. 279670Species Desulfovibrio desulfuricans [TaxId:876] [89025] (3 PDB entries)
  8. 279701Domain d1nf4o_: 1nf4 O: [85612]

Details for d1nf4o_

PDB Entry: 1nf4 (more details), 2.05 Å

PDB Description: x-ray structure of the desulfovibrio desulfuricans bacterioferritin: the diiron site in different states (reduced structure)

SCOP Domain Sequences for d1nf4o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nf4o_ a.25.1.1 (O:) Bacterioferritin (cytochrome b1) {Desulfovibrio desulfuricans}
nredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaenf
aerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivtar
lferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv

SCOP Domain Coordinates for d1nf4o_:

Click to download the PDB-style file with coordinates for d1nf4o_.
(The format of our PDB-style files is described here.)

Timeline for d1nf4o_: