Lineage for d1nf4g_ (1nf4 G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2701406Protein Bacterioferritin (cytochrome b1) [47244] (6 species)
    binds heme between two subunits; 24-mer
  7. 2701409Species Desulfovibrio desulfuricans [TaxId:876] [89025] (3 PDB entries)
  8. 2701432Domain d1nf4g_: 1nf4 G: [85604]
    complexed with fe2, fec, so4

Details for d1nf4g_

PDB Entry: 1nf4 (more details), 2.05 Å

PDB Description: x-ray structure of the desulfovibrio desulfuricans bacterioferritin: the diiron site in different states (reduced structure)
PDB Compounds: (G:) bacterioferritin

SCOPe Domain Sequences for d1nf4g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nf4g_ a.25.1.1 (G:) Bacterioferritin (cytochrome b1) {Desulfovibrio desulfuricans [TaxId: 876]}
nredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaenf
aerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivtar
lferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv

SCOPe Domain Coordinates for d1nf4g_:

Click to download the PDB-style file with coordinates for d1nf4g_.
(The format of our PDB-style files is described here.)

Timeline for d1nf4g_: