Lineage for d1nf4b_ (1nf4 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1989403Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1989404Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1989629Protein Bacterioferritin (cytochrome b1) [47244] (6 species)
    binds heme between two subunits; 24-mer
  7. 1989632Species Desulfovibrio desulfuricans [TaxId:876] [89025] (3 PDB entries)
  8. 1989634Domain d1nf4b_: 1nf4 B: [85599]
    complexed with fe2, fec, so4

Details for d1nf4b_

PDB Entry: 1nf4 (more details), 2.05 Å

PDB Description: x-ray structure of the desulfovibrio desulfuricans bacterioferritin: the diiron site in different states (reduced structure)
PDB Compounds: (B:) bacterioferritin

SCOPe Domain Sequences for d1nf4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nf4b_ a.25.1.1 (B:) Bacterioferritin (cytochrome b1) {Desulfovibrio desulfuricans [TaxId: 876]}
nredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaenf
aerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivtar
lferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv

SCOPe Domain Coordinates for d1nf4b_:

Click to download the PDB-style file with coordinates for d1nf4b_.
(The format of our PDB-style files is described here.)

Timeline for d1nf4b_: