SCOPe 2.03: Domain d1nf3b_: 1nf3 B:

Lineage for d1nf3b_ (1nf3 B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein CDC42 [52619] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52620] (26 PDB entries)

8. Domain d1nf3b_: 1nf3 B: [85595]
   Other proteins in same PDB: d1nf3c_, d1nf3d_
   complexed with gnp, mg

Details for d1nf3b_

PDB Entry: 1nf3, 2.1 Å

PDB Description: structure of cdc42 in a complex with the gtpase-binding domain of the cell polarity protein, par6

PDB Compounds: (B:) G25K GTP-binding protein, placental isoform

SCOPe Domain Sequences for d1nf3b_:

Sequence; same for both SEQRES and ATOM records:

>d1nf3b_ c.37.1.8 (B:) CDC42 {Human (Homo sapiens) [TaxId: 9606]}
gamgiqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglf
dtagledydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtq
idlrddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaa
leppepkksrrcvl

Timeline for d1nf3b_:

• d1nf3b_ first appeared in SCOP 1.65
  
• d1nf3b_ appears in SCOPe 2.02
  
• d1nf3b_ appears in SCOPe 2.04
  
• d1nf3b_ appears in the current release, SCOPe 2.08, called d1nf3b1